PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05831A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 347aa    MW: 38070.9 Da    PI: 6.5857
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05831AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151462148
                               TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd  l+ +++++G+g +W   ++++g++R++k+c++rw++yl
  Oropetium_20150105_05831A 14 KGPWSAEEDAVLKAYIEEHGTGgNWIQLPHKIGLNRCGKSCRLRWLNYL 62
                               79*********************************************97 PP

2Myb_DNA-binding41.53.1e-1369111246
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                g +T+eEd  +  +    G++ W+tIa+ ++ gRt++++k++w++
  Oropetium_20150105_05831A  69 GGFTKEEDNVICSLYISVGSR-WSTIAAQLP-GRTDNDVKNHWNT 111
                                569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.57962IPR017930Myb domain
SuperFamilySSF466898.39E-2712109IPR009057Homeodomain-like
SMARTSM007171.6E-121364IPR001005SANT/Myb domain
PfamPF002495.1E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-231569IPR009057Homeodomain-like
CDDcd001673.15E-91662No hitNo description
PROSITE profilePS5129422.03363117IPR017930Myb domain
SMARTSM007175.2E-1167115IPR001005SANT/Myb domain
PfamPF002497.3E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2270117IPR009057Homeodomain-like
CDDcd001671.95E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSAE EDAVLKAYIE EHGTGGNWIQ LPHKIGLNRC GKSCRLRWLN  60
YLRPNIRHGG FTKEEDNVIC SLYISVGSRW STIAAQLPGR TDNDVKNHWN TKLKRRLLGS  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX LERMQLGMRL HRRHDRLESR PGAFTLYNYG  180
SSSSSSLWPS PSLSPSPSPA ASDCSEMQLR QLPVASSTGC WSHMQSTFSY ACSGAHETLD  240
GTCTPQMSTT TVTGETAAVG MESSSSTPTA SSASATFGSM EDEIDMLLRQ IQSFEEDGQT  300
TDGVDRCFGA VDHVTLDGST GSWSSCSTPG VDSVFQDFVQ GYNQYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632601e-121BT063260.1 Zea mays full-length cDNA clone ZM_BFc0043P16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956887.11e-136PREDICTED: transcription factor MYB35-like
TrEMBLK3ZUK11e-136K3ZUK1_SETIT; Uncharacterized protein
STRINGSi030282m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132652632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.12e-71myb domain protein 87